SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PI73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PI73
Domain Number 1 Region: 18-163,192-256
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-49
Family BAR domain 0.0082
Further Details:      
 
Domain Number 2 Region: 288-474
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.75e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PI73
Sequence length 693
Comment (tr|G1PI73|G1PI73_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000010395} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=SH3BP1 OC=Vespertilionidae; Myotis.
Sequence
MMKRQLHRMRQLAHTGSLGRTPETETAEFLGEDLQQVEQRLEPAKRAAHNVHKRLQACLQ
GQSGSDMDKRVKKLPLMALSTTMAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMT
LERDVLQPLNRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQAAKNSGSGQGLGGGPGS
YGHTTTANKVETLKEEEEELKRKVEQCKDEYLADLYHFATKEDSYANYFINLMEIQADYH
RKSLSSLDTALAELKENHSQAEPSPSMMAAPFSRVYGVSLGAHLQELGRDIALPIEACVL
MLLSEGVKEEGLFRLAAGASVLKRLKQTMASDPRNLQEFCSDPHAVAGALKSYLRELPEP
LMTFDLYDDWMKAASLKEPRARLEALQEVCGRLPQENFSNLSLLLFFVYRLAEDQEVNKM
TPSNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQNADTLFPGDINFNVS
GLFPAPSPQDQVSDRPASEELPAIAVPAPAPAPAPTLAPVPPKERTESEVPPRPASPKVS
RSPPEAAAPAEDMARRTKRPAPARPTMPPPQVSSTRSSPPAPSLSPASGSPVIPRALPRR
LVGSSLRAPTVPPPLPPMPPQPVRRQSRRSPASPSQTSPGPASPSPVSLSMPAQADLGEA
TEDGGGPEAVDGTPTPTAVPPQPRPRSLASETD
Download sequence
Identical sequences G1PI73
ENSMLUP00000010395 ENSMLUP00000010395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]