SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PI95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PI95
Domain Number 1 Region: 5-214
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-45
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 202-334
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PI95
Sequence length 335
Comment (tr|G1PI95|G1PI95_MYOLU) Rho guanine nucleotide exchange factor 39 {ECO:0000313|Ensembl:ENSMLUP00000010417} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=ARHGEF39 OC=Vespertilionidae; Myotis.
Sequence
MESPGPRARCPVQEQRARWERKRACTARELLETERRYQEQLGLVATYFLGILRAKGTLRP
PERQALFGPWELIYGASQELLPYLEGGHWGQGLEGFCPHLELYTQFAANAERSQTTLQEQ
LKKSKRFRRFVRLQEGRPEFGGLQLQDLLPLPLQRLQQYENLVVALAENTSPNSPDHQQL
TRAARLISETAQRVHTIGQKQKNDQHLRRVQALLSGRQAKGLTSGRWFLRQGWLLVVPPR
GEPRPRMFFLFSDVLVLAKPRPPLHLLQSGTFLCRAVYPMAQCQLQRVFGHSGGPCGGLL
SLSFPHEKLLLMSTDREELLRWYHSLTVAISSQKN
Download sequence
Identical sequences G1PI95
ENSMLUP00000010417 ENSMLUP00000010417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]