SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PJ34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PJ34
Domain Number 1 Region: 647-841
Classification Level Classification E-value
Superfamily Sec7 domain 2.09e-76
Family Sec7 domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 404-587,1103-1115,1149-1492
Classification Level Classification E-value
Superfamily ARM repeat 5.28e-26
Family HspBP1 domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PJ34
Sequence length 1809
Comment (tr|G1PJ34|G1PJ34_MYOLU) ADP ribosylation factor guanine nucleotide exchange factor 1 {ECO:0000313|Ensembl:ENSMLUP00000010748} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=ARFGEF1 OC=Vespertilionidae; Myotis.
Sequence
EEIKVETEKQSPPHGEAKAGSSTLPPVKSKANFIEADKYFLPFELACQSRCPRIVNTSLD
CLQKLIAYGHLTGNAPDSTTPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTS
QHIEIHEGTVLQAVRTCYNIYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQME
KERHRHHHHLLQSPVSHHEPESPHLRYLPPQTVDHISQEHERDLDPHTNDVDKSLQDDIE
PENGSDISSAENEQTEADQATAAETLSKNDILYDGENHDCEEKPQDIVQSIVEEMVNIVV
GDMGERTINANADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQE
SGNSSGPSPGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLS
ILQNAGPVFRTNEMFINAIKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQ
IEVFFKEIFLYILETSTSSFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERL
VNDLSKIAQGRGSQELGMSNVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGK
EKPSEQETSDIKHPETINRYGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQKEII
EQGIDLFNKKPKRGIQYLQEQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEV
MYAYVDQHDFSGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASAD
TAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKI
SLKETKELAIPTKSSKQNVANEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHL
EHVRPMFKLAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQA
LARFTLLTVSSGITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGT
GVKPRYISGTVRGREGSLTGTKDQAPDEFVGLGLGVVVGGNVDWKQIASIQESIGETSSQ
SVVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELLSTTHPRMFSLQKIVEISYYNMGR
IRLQWSRIWEVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRP
FEHIMKRNRSPTIRDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQ
TTGHIVTLVFEKHFPATIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQ
AFKEYTSDDMNVAPEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKTYGHTY
EKHWWQDLFRIVFRIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLD
DIFAQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKTCNCTLDIFKTTIPHAL
LTWRPTSGETVPVPSSPVSEKQLDTISQKSVDIHDSIQPRSADNRQQATLASVSTVNEEA
NKIKPSAKYPEQKLFAALLIKCVVQLELIQTIDNIVFFPATSRKEDAENLAAAQRDAVDF
DVRDTQDQGMYRFLTSQQLFKLLDCLLESHRFAKAFNSNNEQRTALWESSFKGKSKPNLL
KQETSSLACGLRILFRMYMDESRVSAWEEVQQRLLNVCSEALSYFLTLTSESHREAWTNL
LLLFLTKVLKISDNRFKAHASFYYPLLCEIMQFDLIPELRAVLRRFFLRIGVVFQISQPP
EQELGLNKQ
Download sequence
Identical sequences G1PJ34
ENSMLUP00000010748 ENSMLUP00000010748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]