SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PJ43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PJ43
Domain Number 1 Region: 10-199
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-21
Family Ankyrin repeat 0.0022
Further Details:      
 
Domain Number 2 Region: 513-563
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000141
Family RING finger domain, C3HC4 0.00094
Further Details:      
 
Domain Number 3 Region: 330-370
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000663
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Domain Number 4 Region: 406-487
Classification Level Classification E-value
Superfamily RING/U-box 0.00000119
Family RING finger domain, C3HC4 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PJ43
Sequence length 1094
Comment (tr|G1PJ43|G1PJ43_MYOLU) RING-type E3 ubiquitin transferase {ECO:0000256|SAAS:SAAS00970528} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=ANKIB1 OC=Vespertilionidae; Myotis.
Sequence
MGNTTTKFRKALINGDENLACQIYENNPQLKESLDPNTSYGEPYQHNTPLHYAARHGMNR
ILGTFLFGRDGNPNKRNVHNETSMHLLCMGPQIMISEGALHPRLARPMEDDFRRADCLQM
ILRWKGAKLDQGEYERAAIDAVDNKKNTPLHYAAASGMKTCVELLVKHGGDLFAENENKD
TPCDCAEKQHHKDLALNLESQMVFSRDPEAEEIEAEYAALDKREPYEGLRPQDLRRLKDM
LIVETADMLQAPLFTAEALLRAHDWDREKLLEAWMSNPENCCQRSGVQMPTPPPSGCNAW
DTLPSPRTPRTTRSSVTSPDEISLSPGDLDTSLCDICMCSISVFEDPVDMPCGHDFCRGC
WESHINMLVDDLNEAWNLFITKMKKFLLCEKGTLQGYLLKKMDKKQLKYDLKAFVENNPA
IKWCPTPGCERAVRLTKQGSNTSGSDTLSFPLLRAPAVDCGKGHLFCWECLGEAHEPCDC
QTWKNWLQKITEMKPEELVGVSEAYEDAANCLWLLTNSKPCANCKSPIQKNEGCNHMQCA
KKCKYDFCWICLEEWKKHSSSTGGYYRCTRYEVIQHVEEQSKEMTVEAEKKHKRFQELDR
FMHYYTRFKNHEHSYQLEQRLLKTAKEKMEQLSRALKETEGGCPDTTFIEDAVHVLLKTR
RILKCSYPYGFFLEPKSTKKEIFELMQTDLEMVTEDLAQKVNRPYLRTPRHKIIKAACLV
QQKRQEFLASVARGVAPADSPEAPRRSFAGGTWDWEYLGFASPEEYAEFQYRRRHRQQRR
RGDVHSLLSNPPDPDEPSESTLDLPEGGSGRRPGTSVVSSASMSVLHSSSLRDYTPASRS
ENQDSLQALSSLDEDDPNILLAIQLSLQESGLAIDEGNRDFLSGDASLGAIGTSLPSRLD
SGPRNTDSPAAALSSSELLELGDSLLRLGAESDTFSTDTLSSHPLSEARNEFYPSSSDPD
SAGQDANISDNLLGNIMAWFHDMNPQSIVLIPPATTETSADSQRPCVGDGSEGVKDVELV
PPEEDSVFEDAVVSEGRGTQREEENSLEENILAGEAVPQAGESGTEAASKGAGSDVSSQT
PQTSSDWLEQGHLV
Download sequence
Identical sequences G1PJ43
ENSMLUP00000010757 ENSMLUP00000010757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]