SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PJF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PJF0
Domain Number 1 Region: 115-179
Classification Level Classification E-value
Superfamily beta-catenin-interacting protein ICAT 3.27e-25
Family beta-catenin-interacting protein ICAT 0.00097
Further Details:      
 
Weak hits

Sequence:  G1PJF0
Domain Number - Region: 5-60
Classification Level Classification E-value
Superfamily Ferritin-like 0.0284
Family Ferritin 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PJF0
Sequence length 195
Comment (tr|G1PJF0|G1PJF0_MYOLU) Leucine zipper and CTNNBIP1 domain containing {ECO:0000313|Ensembl:ENSMLUP00000010874} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=LZIC OC=Vespertilionidae; Myotis.
Sequence
RGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDADEYEETKKETLEQLSEFNDSLKKI
MSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLE
RDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKVLALASF
EVENKKMTWCGSLGQ
Download sequence
Identical sequences G1PJF0
ENSMLUP00000010874 ENSMLUP00000010874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]