SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PJH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PJH0
Domain Number 1 Region: 287-429
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 183-288
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-37
Family Second domain of FERM 0.00000422
Further Details:      
 
Domain Number 3 Region: 103-182
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-27
Family First domain of FERM 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PJH0
Sequence length 962
Comment (tr|G1PJH0|G1PJH0_MYOLU) Erythrocyte membrane protein band 4.1 like 1 {ECO:0000313|Ensembl:ENSMLUP00000010899} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=EPB41L1 OC=Vespertilionidae; Myotis.
Sequence
MTTETGPDSEVKKAQEEAPQQPEAAAAAAVTTPVTPAGHGHPEANSNEKQPPQQETRPAE
QDLQSLDMDEKDNGEADGLSERTTPSRAQKSPQKIAKKYKSAICRVTLLDASEYECEVEK
HGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKF
YPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGN
YVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEG
IDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLP
NHRSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAP
FFERSSSKRYTMSRSLDGALWTQDVAHKHLNEHNGQVSILPQMPQQENQHLSEFSRPASV
SENHDAGPDGDKREEDGESGGRQSEAEEGEVRTPTKIKEIDISLSPRDVYKPEDVLLKHQ
ASINELKRTLKEPNSKLIHRDRDWERERRLPSSPASPSPKGTPEKASEEGPSEPTRGKPA
APVPFRVLSLSSGPGPPLQSQRTQDTSQQDLAPEPGTATGLEVFTQKSLAASPEQNYQHS
LERSWTGVNSISRLAQSRDFKGGKNWLNGCWLSKRISKCTESLEPEAMPVTPHPSPLFQA
DDQLAFYVPLRDQKRRQGTSSGAGAGPEHEEVDGKERDRVTRYVEEGKGGSEALPGKEEA
VAQEAACQGKGRQRAPSSRAPRQAEARPHNVSEGVGQGSHFKNMCILSERLSASNVNPVA
IKCSVEPRRLPFRMQHQETISFSDAHRFPGAIIGKDVLTSTYGATAETLSTSTTTHVTKT
VKGGFSETRIEKRIIITGDEDVDQDQALALAIKEAKLQHPDMLVTKAVVYRETDPSPEER
DK
Download sequence
Identical sequences G1PJH0
ENSMLUP00000010899 ENSMLUP00000010899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]