SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PJK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PJK3
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-33
Family Ras-binding domain, RBD 0.002
Further Details:      
 
Domain Number 2 Region: 311-425
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PJK3
Sequence length 659
Comment (tr|G1PJK3|G1PJK3_MYOLU) Amyloid beta precursor protein binding family B member 1 interacting protein {ECO:0000313|Ensembl:ENSMLUP00000010936} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=APBB1IP OC=Vespertilionidae; Myotis.
Sequence
MDESNDDIDQMFSNLLGEMDLLTQSLGVDTLPPPDPKPPRAEFNYSVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKESSQGPYHQAPPEVSHFSGAASPGYGANVVATS
MSQCEDDLPPPPADPMLDLPLPPPPPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVV
KVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCSVDWCLYEIYPELQLERFFEDHENV
VEVLSDWTRDTENKVVFLKKEEKYAVFKNPQNFYLDNKGKKESKETNEKMNAKNKECLLE
ESFCGTSVIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFE
NVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDERTLNQWVTGIRIAKYG
KTLYDNYQRAVAKAGLASRWTNLGTGNAATPTPPSTGLTAGTAQANGQIPQAAHSVSAVP
EEAQRHVDTTKDKKPALGQPDPGTPKVHHRPKSSMPPPPPIRRSSDTSGSPVIPAKAKGT
GFPAPPDDFLPPPPPPPPLEDPELPPPPPDFNDSPPDFVPPPPPSFVGDAGSLPPPPPPP
PALAPESPRPPPIATKRPPIPPKRQENPGPPSAGAGGGGEQDFMSDLMKALQKKRGNLP
Download sequence
Identical sequences G1PJK3
XP_006100319.1.53796 ENSMLUP00000010936 ENSMLUP00000010936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]