SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PJQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PJQ0
Domain Number 1 Region: 328-585
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.89e-99
Family STAT DNA-binding domain 0.0000552
Further Details:      
 
Domain Number 2 Region: 137-333
Classification Level Classification E-value
Superfamily STAT 2.94e-54
Family STAT 0.00015
Further Details:      
 
Domain Number 3 Region: 2-125
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.83e-39
Family Transcription factor STAT-4 N-domain 0.00041
Further Details:      
 
Domain Number 4 Region: 586-708
Classification Level Classification E-value
Superfamily SH2 domain 1.16e-33
Family SH2 domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PJQ0
Sequence length 787
Comment (tr|G1PJQ0|G1PJQ0_MYOLU) Signal transducer and activator of transcription {ECO:0000256|RuleBase:RU046415} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=STAT5B OC=Vespertilionidae; Myotis.
Sequence
NMAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQPWDSIDLDNPQENIKATQ
LLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRL
VREANNGASPAGSLADIMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQES
LRIQAQFAQLAQLNPQERLSRESALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQL
LRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHL
CQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGK
LNVHMNPPQVKATIISEQQAKSLLKNENTRNEYSGEILNNCCVMEYHQATGTLSAHFRNM
SLKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNAT
ATVLWDNAFAESGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFN
SSSSHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVN
KQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADR
LGDLDYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVTSADSAG
GSATYMDQAPSPAVCPQAHYNMYPQNPDPALDPDGDFDLDDTMDVARRVEELLGRPMDTQ
WIPHAQS
Download sequence
Identical sequences G1PJQ0
ENSMLUP00000010987 ENSMLUP00000010987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]