SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PJU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PJU4
Domain Number 1 Region: 15-157
Classification Level Classification E-value
Superfamily ENTH/VHS domain 2.78e-47
Family VHS domain 0.000000212
Further Details:      
 
Domain Number 2 Region: 585-723
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 2.48e-45
Family gamma-adaptin C-terminal appendage domain-like 0.0000089
Further Details:      
 
Domain Number 3 Region: 173-301
Classification Level Classification E-value
Superfamily GAT-like domain 3.34e-36
Family GAT domain 0.00000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PJU4
Sequence length 727
Comment (tr|G1PJU4|G1PJU4_MYOLU) Golgi associated, gamma adaptin ear containing, ARF binding protein 2 {ECO:0000313|Ensembl:ENSMLUP00000011035} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=GGA2 OC=Vespertilionidae; Myotis.
Sequence
IMRSEGEEMSSEWSDKATDPSMPEQDWSAIQNFCDQVNTDPNGPTHAPWLLAHKIQSPQE
KEALYALTVLETCVNHCGEKFHNEVAKFRFLNELIKVLSPKYLGSWTTEKVKGRVIEILF
SWTVWFPEDIKIRDAYQMLKKQGIVKQDPKLPVDKILPPPSPWPRSSIFDADEEKSKLLT
RLLKSSHPEDLQAANRLIKSLVKEEQEKSEKVSKRVSAVEEVRSHVKVLQEMLSRYRRPG
QAPPDQEALQVVYERCEKLRPTLFRLASDTVDDDDALAEILQANDLLTQGVLLYKQVMEG
RVIFGNTVTSTAGDTPDSRGNVQRASLYLLLGAASDPRHRSRWLIAPSGQAPRRGSELAK
PAGCVQAEWTTRGGLATGGKAVLWLLIPGPTQALCQALHLRWKVLGVLRVGCCDVLTGRR
PEKEVGILGSSERSSWHLVSAERSVLDLLSPQPPSGALRAGVTLEDGQRHRSAEASLLPS
PPFTTIPSEERTPLAKVSVEDLSIASSLEALGEVVIFSHHSTGASHSYFDGLLLSGLQFS
KMFSVCVANGQNPKEEVPPGTKSSPGWSWEAGPLASSSSSQNTPLAQVFVPLESVKPSSL
PPIIVYDRNGFRILLHFSQTGAPGHPEVQVLLLTMMSTATQPVWDIMFQVAVPKSMRVKL
QPASSSQLPAFSPLMPPAVISQMLLLDNPHKEPIRLRYKLTFNQGGQPFSEVGEVKDFPD
LAVLGAA
Download sequence
Identical sequences G1PJU4
ENSMLUP00000011035 ENSMLUP00000011035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]