SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PJZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PJZ5
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-45
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000195
Further Details:      
 
Weak hits

Sequence:  G1PJZ5
Domain Number - Region: 208-314
Classification Level Classification E-value
Superfamily Ferritin-like 0.00243
Family Ferritin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PJZ5
Sequence length 360
Comment (tr|G1PJZ5|G1PJZ5_MYOLU) Homer scaffolding protein 3 {ECO:0000313|Ensembl:ENSMLUP00000011092} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=HOMER3 OC=Vespertilionidae; Myotis.
Sequence
LSPCREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELTSPALGLSTHQVPPSPLISTNGPPSDEKLFRSQSAEAPGPAERERLKKMLSEGS
VGEVQWEAEFFALQDSNNKLASALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAA
TEPTPVSEKEGPGQALEQLESLVQTKDQEIQTLKSQAGVPREAPDAVDRDETQQKVQDLE
TRNVELEHQLRVTERSLEEARAERERARAEVGRAAQLLDVRLFELSELREGLARLAEGAP
Download sequence
Identical sequences G1PJZ5
ENSMLUP00000011092 ENSMLUP00000011092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]