SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PK06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PK06
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-26
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 2 Region: 254-368
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000262
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 457-494
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 167-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 213-252
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 418-455
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  G1PK06
Domain Number - Region: 368-416
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00184
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PK06
Sequence length 771
Comment (tr|G1PK06|G1PK06_MYOLU) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSMLUP00000011105} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=LRP3 OC=Vespertilionidae; Myotis.
Sequence
MFFTVNIVLTGRLSSAVPALGESGAVWGMCCEASTSPPLLTAACSGKLEQHTERRGVIYS
PAWPLNYPPGTNCSWYIHIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAF
RLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGK
CLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAERRCDGT
QDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDTRRVLLQ
LELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHG
FNATYQVKGYCLPWEQPCGSSIEGDMGDTGEQGCFSEPQRCDGWWHCASGRDEQGCPACP
PDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQ
EDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQM
TRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRR
GPSRRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPAPGAALDPPAPLTDT
GSAGAAGDGSPSAPVHTPEVGPSVLPPLSLQDPEYRPVDKDRKACRDPLMDSPASVDTPR
EPCSAQDPHSLAPTAGSTLGPHPPEPLGVCRSPPPPCSPTEASDDEALLVC
Download sequence
Identical sequences G1PK06
ENSMLUP00000011105 ENSMLUP00000011105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]