SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PKG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PKG0
Domain Number 1 Region: 206-300
Classification Level Classification E-value
Superfamily Cadherin-like 7.46e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 97-204
Classification Level Classification E-value
Superfamily Cadherin-like 6.94e-23
Family Cadherin 0.0054
Further Details:      
 
Domain Number 3 Region: 513-625
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 4 Region: 403-520
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-16
Family Cadherin 0.0035
Further Details:      
 
Domain Number 5 Region: 326-408
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000249
Family Cadherin 0.0081
Further Details:      
 
Domain Number 6 Region: 2-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000257
Family Cadherin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PKG0
Sequence length 926
Comment (tr|G1PKG0|G1PKG0_MYOLU) Protocadherin 10 {ECO:0000313|Ensembl:ENSMLUP00000011283} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PCDH10 OC=Vespertilionidae; Myotis.
Sequence
LHYTVQEEQEHGTFVGNIAEDLGLDITKLSARRFQTVPNSRTPYLDLNLETGVLYVNEKI
DREQICKQSPSCVLHLEVFLENPLELFRVEIEVLDINDNPPSFPEPDLTVEISESATPGT
RFPLESAFDPDVGTNSLRDYEITPNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRY
VLTAVDGGGGQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPD
EGQNGEVVYSFSSHISPRARELFGLSSRTGRLEVSSLDYEESPVYQVYVQAKDLGPNAVP
AHCKGAGAGCLDANDKRAGRSASAPAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLK
SSFKNYYTIVTEAPLDREADSYTLTVVGPGGEPSLSTSKSIQVQVSDVNDKRAFPPSRVY
DVTENNVPGAYIYAVSATDRDEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRS
FDYEQLFHVEARDAGSSGAGGQRTVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAE
PGYLLTRVAAVDADDGENARLTYSIVRGNEMNLFRMDWRTGELRTARRVPAKRDPQRPYE
LVIEVRDHGQPPLSSTATLVVQLVDGAVEPQGGGGGGGGGSGEHQRPNRSGGGETSLDLT
LILIIALGSVSFIFLLAMIVLAVRCQKEKKLNIYTCLASDCCLCCCCGSGGSTCCGRQAR
ARKKKLSKSDIMLVQSSNVTSNPAQVPVEESGGFGSHHHNQNYCYQALINCLNSNYTPKH
FFRPLKERLQSITRLTLLETIVYEPQTKHQRAELSYLVDRPRRVNSSAFQEADIVSSKDS
GHGDSEQGDSDHDATNRGHLVKVLSMSFSNRLFLRSEEIPSGMDLFSNCTEECKALGHSD
RCWMPSFVPSDGRQAADYRSNLHVPG
Download sequence
Identical sequences G1PKG0
ENSMLUP00000011283 ENSMLUP00000011283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]