SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PKW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1PKW2
Domain Number - Region: 17-109
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00774
Family Arfaptin, Rac-binding fragment 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PKW2
Sequence length 388
Comment (tr|G1PKW2|G1PKW2_MYOLU) Tripartite motif containing 8 {ECO:0000313|Ensembl:ENSMLUP00000011465} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=TRIM8 OC=Vespertilionidae; Myotis.
Sequence
QYCCYYSGAHQGHSVCDVEIRRNEIRKMLMKQQDRLEEREQDIEDQLYKLESDKRLVEEK
VSQLKEEVRLQYEKLHQLLDEDLGQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLG
SLQLLFDKTEDVSFMKKKTSDAPSTAPRTQTCTGNSLSPPKIGHLNSKLFLNEVAKKEKQ
LRKMLEGPFSTPVPFLQSVPLYPCGVSSSGAEKRKHSMAFPEASFLETSSGPVGSQYGAA
GTASGEGQSGQPLGPCSSTQHLVALPGGAQPVHSSPVFPPSQYPNGSAAQQPMLPQYGGR
KILVCSVDNCYCSSVANHGGHQPYPRSGHFPWTVPSQEYSHPLPPAPSVPQSLPGLAVRD
WLDASQQPGHQDFYRVYGQPSTKHYVTS
Download sequence
Identical sequences G1PKW2
ENSMLUP00000011465 ENSMLUP00000011465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]