SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PLN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PLN5
Domain Number 1 Region: 629-821
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-48
Family SPRY domain 0.0000751
Further Details:      
 
Domain Number 2 Region: 6-94
Classification Level Classification E-value
Superfamily RING/U-box 1.04e-29
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 336-424
Classification Level Classification E-value
Superfamily RING/U-box 3.12e-23
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 4 Region: 97-159
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-17
Family B-box zinc-binding domain 0.0017
Further Details:      
 
Domain Number 5 Region: 423-487
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000901
Family B-box zinc-binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  G1PLN5
Domain Number - Region: 448-575
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.068
Family FCH domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PLN5
Sequence length 823
Comment (tr|G1PLN5|G1PLN5_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000011776} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
GARRMATMTSAVLVDIQDEVTCPICLELLKEPLSIDCGHSFCQACITENSKESQIGQEEE
SSCPVCQTSYQLRNLRPNRHLANIAERLREVVLGSGEPLKVILCAHHREKLQLFCKEDGK
LICWLCERSQEHRGHHTFLMEEVAQEYQEKFQESLKRLRQEQQEAEKLKAVIIEKRTSWK
NQMEPERHRIQTEFNQLRSILDKEEQRQLKKLEEEERKGLNIMEEAEDELAHQSQALKEL
ISDLERRCQGSTVELLQDVSDVTERSEYWALKKPEDLPTKLKSAFRAPDLKKMLRVFREL
TDVQSYWGKCCLPGSRTRPNTKVSHIRHEETRGAAAMALKFLVNMKEKVTCAICLELLTE
PLSLNCGHSFCQACITDNKASEIGPGGESSCPVCGVRYSFGNLWLNQHLANIVERVKEVK
LSPEEGQKKDLCLSHGERLRLFCKEDRKAICQLCEWSREHCGHQIFLMEEVVKECQEKLQ
AALDRLRREHQEAEKLGSDIREERTSWKNQIQAEKQRIHTEFNQLRSILDSEEQRELQKL
EEEEMKTLQDLAEAENELVQQSQLLKELISDLERRSEWSAMELLQDTSGIMKWSEVWTLK
KPKTISKKLKHGFHAPDLSGMLHMFKELTRVQRYWVDMTFNPFNLNLNLNLSEDHRQLAS
VPIWPIKYYNYGVLGSQYFSSGKHYWEIDVSKKTAWILGVYCRKRSCNKKFGVRRGTNYP
NAYSRFRPENGYWVVSLQNESEYNAFEDSSTSDPKVLTLSMAVPPRRVGVFLDYEASTVS
FFNVTNHGSLIYKFSKCHFSQTVYPYFNPWNCPAPMTLCPPSS
Download sequence
Identical sequences G1PLN5
ENSMLUP00000011776 ENSMLUP00000011776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]