SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PMH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PMH3
Domain Number 1 Region: 21-95
Classification Level Classification E-value
Superfamily HR1 repeat 5.23e-18
Family HR1 repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 499-589
Classification Level Classification E-value
Superfamily PDZ domain-like 6.74e-17
Family PDZ domain 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PMH3
Sequence length 685
Comment (tr|G1PMH3|G1PMH3_MYOLU) Rhophilin Rho GTPase binding protein 2 {ECO:0000313|Ensembl:ENSMLUP00000012102} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RHPN2 OC=Vespertilionidae; Myotis.
Sequence
VYPPLPLSLKTINKKNFFKKGGCNPFAQTGRSKLQNQRAALNQQILKAVRMRTGAENLLK
AATNHKVREQVRLELSFVNSDLQMLKEELEGLNISVGVYQSTEETFTIPLIPLGLKETKD
VDFSVVLKDFILEHYSEDSYLYEDEIADLMDLRQACRTPSRDEAGVELLMSYFLQLGFVE
SRFFPPTRQMGILFTWYDSLTGVPVSQQNLLLEKASILFNTGALYTQIGTRCNRQTQAGL
EGAMDAFQKAAGVLNYLKETFTHTPSYDMSPAMLSVLVKMMLAQAQETVFEKICLPGIQN
EFFMLVKVAQEAAKVGEVYQQLHAAMSQAPVKENIPYSWASVACVKAHHYGALAHYFVAT
LLIDHQLKPGTDEDHQEKCLSQLYDHMPEGLTPLATLKNSNQRRQLGKSHLRKAIAHHEE
SVRGVSLCKKLRNIELLQEVLSVAHQRSQLKYTQHQEDDDLLNLIDVPDIISKTEQEVEI
IVPQFSKVTATDFFQKLGPLSVFSANKRWTPPRSIHFTAEEGDLGFTLRGNSPVQVHFLD
PYCSAALAGAKEGDYIVSIQNVDCKWLTVSEVMKLLKSFGEDDIEMKVVSLLDSTSSMHN
KCATYSVGMQKTYSMICLAIDDDDDKTGKTKKISKKLSFLSWGTNKNRQKSASTLCLPSV
GVVRPQVKKKLPSPFGLLNSDSSMY
Download sequence
Identical sequences G1PMH3
ENSMLUP00000012102 ENSMLUP00000012102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]