SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PMT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PMT0
Domain Number 1 Region: 37-91
Classification Level Classification E-value
Superfamily PH domain-like 0.00000182
Family Pleckstrin-homology domain (PH domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PMT0
Sequence length 646
Comment (tr|G1PMT0|G1PMT0_MYOLU) Family with sequence similarity 129 member B {ECO:0000313|Ensembl:ENSMLUP00000012217} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=FAM129B OC=Vespertilionidae; Myotis.
Sequence
AYERHVPPRAVINSAGYKILTSVDQYLELVGNSLPGITSKSGTAPILKCPTQFPLILWHP
SARHYYFCMMTEAEQEKWQAVLQDCIRHCNNGEWGNTTIKGRDAGEVLRPQPKAKPGLWE
TLLPQEREGVALLAQGWGPAAASTLSPVLTPPLCPQISDAVYRLVYEQAKAHFEAVLSKL
LLARPAMEAVIRTDMDQIITSKEHLASKIRAFILPKAEICVRNHVQPYISSILEALMVPT
SQGFTEVRDVFFKEVTDMNLNVINEGGVDKLGEYMEKLSQLAYHPLKMQSCYEKMEPLRL
DGLQQRFDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKVPTKEDLCKSIQRILE
RVLKKYDYDSSSVRKRFFREALLQITIPFLLKKLAPTCKSELPRFQELIFEDFARFILVE
NTYEEVVLQTVMKDILQAVKEAAVQRKHNLYRDSVVLHNSDPNLHLLAEGSPINWGEEYG
GSDGGSGGSGSPSPGVQEAATISEKRRRAKQVVSVVQDEEAGLPFEVGCEPPSPASPDSV
TEVRDLLAQDLRVESPPPACPLLNGAPVPAIPVPSSPSPSSPPAASPPPAASPRASPLQQ
LPPGKAVDLEPPKPNDQETGEQESSPGGRPPIHTTTEDSAGVQTEF
Download sequence
Identical sequences G1PMT0
ENSMLUP00000012217 ENSMLUP00000012217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]