SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PN14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PN14
Domain Number 1 Region: 402-513
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-21
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 2 Region: 583-690
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-20
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 3 Region: 696-761
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000262
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 755-817
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000904
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 342-407
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000625
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 822-882
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000917
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 225-343
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000654
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 
Domain Number 8 Region: 518-582
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000132
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PN14
Sequence length 980
Comment (tr|G1PN14|G1PN14_MYOLU) Seizure related 6 homolog {ECO:0000313|Ensembl:ENSMLUP00000012311} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=SEZ6 OC=Vespertilionidae; Myotis.
Sequence
SVVISGLSSEAPTMAEGQAPGIEETDGEWTVAPTPEQPERGIHFVTTAPTLKLLNHHPLL
EEFLQEGLETGEELRPALPFQPDPPTPQTPSPLPRLANQDSRPVFTSPTPAIAAAPTQPP
SREGPWSLESEPPELHVTAPLPPGPSMAVPTTGPGEKLGTTPPSRAWTPTQEGPGDMGRP
WAPEVMSRTTGLGIEGTIATSTASGDDEETTTTTTIITTTITTVQPPGPCSWNFSGPEGS
LDSPSAPSSPHDVGLDCFYYISVYPGYGVEIKVRNISLREGETVTVEGLGGPDPLPLANQ
SFLLRGQVIRSPTHQAALRFQSLPPSAGPGTFHFHYQAYLLSCHFPRRPAYGAVTVTSLH
PGGSARFHCATGYQLKGARLLTCLNATQPFWDSQEPICIAACGGVIRNATTGRIVSPGFP
GNYSNNLTCHWLLEAPESQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPVYDSYEVEYLP
IEGLLSSGRHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGNFSSSAPSYPVGTT
VEFSCDPGYTLEQGSIIIECVDPHDPQWNETEPACRAVCSGEITDSAGVVLSPNWPEPYG
RGQDCIWGVHVEEDKRIMLDVRVLRIGPGDVLTFYDGDDLTARVLGQYSGPRGHFKLFTS
MADVTIQFQSDPGTSVLGYQQGFVIHFFEVPRNDTCPELPEIPNGWKSPSQPELVHGTVV
TYQCYPGYQVVGSSILMCQWDLTWSEDLPSCQRVTSCHDPGDVEHSRRLISSPKFPVGAT
VQYICDQGFVLTGSAILTCHDRQASSPKWSDRAPKCLLEQLKPCHSLSAPENGACSPEKR
LHPAGATVHFSCAPGYVLKGQASIKCVPGNPSHWSDPPPICRAASLDGFYSGRSLDVAKA
PAASSTLDAAHIAAAIFLPLVAMALLVGGVYLYFSRLQGKSPRQLPGTRPRAYDRITVES
AFDNPTYETGSLSFAGDERI
Download sequence
Identical sequences G1PN14
ENSMLUP00000012311 ENSMLUP00000012311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]