SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PNA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PNA2
Domain Number 1 Region: 393-615
Classification Level Classification E-value
Superfamily VPS9 domain 6.67e-44
Family VPS9 domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PNA2
Sequence length 621
Comment (tr|G1PNA2|G1PNA2_MYOLU) VPS9 domain containing 1 {ECO:0000313|Ensembl:ENSMLUP00000012413} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=VPS9D1 OC=Vespertilionidae; Myotis.
Sequence
QEAYAEYLRSIHYIQVLLEEVETTQDAGEPVTPDALKMLKLAEQCLERAQSTVAKLGKAC
LKPAMPVAAAGPSPTSRHRRVYSDEGGKLLPFLPPEIFQRLQVVESQSSKKELTPLEEAS
LQNQKLKAAYEARMARLDPSQALQKTSLTLSLQRQMMENLVIAKAREETLQRKMEERRLR
LQEAANRRFCSQVTLTPEEREQRALYAAILEYEQDHDWPKHWKAKLKRSPGDLSLVTGLV
SHLLSVPDHPIAQLLKKLQCAVYRALYHVVSRGAAAAPAPGGCSLPPDAEGLLAPGSRRL
RPSQSLYCMLSPPEPSPAPHPPAGPPTSPPHTHSSPGPPTEGQTAALRGLSHSWCAKDSS
FEDLGTVPGHFREVGPGALGGGTDPQASGVKEEPLLEPLKSIVKDIHNAVDRLLSLTLLA
FEGLNTAVSKDRCLACIEEPFFSPLWPLLLALYRSVYRPREAALSRSMELYSNAPPAALG
IPPKLLPRDPEASGASTYPYDAAAQELGLLVLECCPQKKLDCIVRALRVICACAEGYYWA
QEPAPEARPQPGAAAIGADDLLPILSFVVLRSGLPQLVSECAALEEFIHEGYLIGEGGYC
LTSLQSALSYVELLPRGALGK
Download sequence
Identical sequences G1PNA2
ENSMLUP00000012413 ENSMLUP00000012413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]