SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PNP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PNP1
Domain Number 1 Region: 377-575
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.52e-69
Family Nuclear receptor ligand-binding domain 0.0000128
Further Details:      
 
Domain Number 2 Region: 100-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-29
Family Nuclear receptor 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PNP1
Sequence length 577
Comment (tr|G1PNP1|G1PNP1_MYOLU) Nuclear receptor subfamily 1 group D member 2 {ECO:0000313|Ensembl:ENSMLUP00000012574} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=NR1D2 OC=Vespertilionidae; Myotis.
Sequence
FSFFLGGVIAYISSSSSASSPASCHSEGSDNSFQSSFSSVPSSPNSSNSDNNGNPKSGDL
SSIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHAC
EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKSMMNSQFSGHLQNDTLVDHEQTALPAQEQLRPKPQLEQESIKSS
SPPSSDFAKEEVIGMVTRAHKDTFLYNQEQRENSAETMQPQRERIPKNLEQYNLNHDHCG
NGLSSHFPCSESQQNLNGQYKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVSIDG
FSQNENKNSYLCNNGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKR
IPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDL
LNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLITK
NHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences G1PNP1
ENSMLUP00000012574 ENSMLUP00000012574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]