SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PP39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PP39
Domain Number 1 Region: 441-575
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-30
Family Cadherin 0.0035
Further Details:      
 
Domain Number 2 Region: 237-347
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-27
Family Cadherin 0.00098
Further Details:      
 
Domain Number 3 Region: 128-235
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-26
Family Cadherin 0.0059
Further Details:      
 
Domain Number 4 Region: 341-445
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-18
Family Cadherin 0.0096
Further Details:      
 
Domain Number 5 Region: 557-666
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-16
Family Cadherin 0.002
Further Details:      
 
Weak hits

Sequence:  G1PP39
Domain Number - Region: 30-89
Classification Level Classification E-value
Superfamily Cadherin-like 0.00173
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PP39
Sequence length 819
Comment (tr|G1PP39|G1PP39_MYOLU) Protocadherin beta 1 {ECO:0000313|Ensembl:ENSMLUP00000012751} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PCDHB1 OC=Vespertilionidae; Myotis.
Sequence
MAVVRRKLLQSRQVGSLLLFLCISVGGEATIRYSVAEEMESGSFVANVAKDLGLEVGKLA
ARGARLVSEGNRLHFRLHRKTGDLFVKGETGIGSHSVAKPTPCVLHFEIVLVEPLQSFRA
EVRVFDINDNAPIFPNKEPLLKIPESTPLGSRFPLQSAQDLDVGLNGLQNYTLSANAYFH
LHTRFRSHGPKYAELVLDKPLDREEHPEVNLTITAVDGGSPPKSGTAHIRVEVLDVNDHV
PQFSRLVYRAQVPEDSANGSLVVTVTATDLDEGSNKKITYSLAQNPEAILQTFQIDSETG
EVRLRGPLDFEAIETYDIDIQATDGGGLSAHSKVLVEVVDVNDNPPEVTVSSVSSPLPED
SPLQTVVALFSIRDRDVQVGGKITCFLREDLPFAVKPTFRNAYSLVTDRGLDREEVSGYN
ITLVAMDTGPPNLSTETVIEVLISDINDNPPVFREDSYILTVRENNSPAVFIGKVHAEDL
DLGENAQVTYSLLPPKSGDLSVFAYISINSDNGKLYALRTMDYEAIQDFQFVIKATDGGF
PSLSSQVTVRVVVLDDNDNRPMILYPLQNGTLPCNDLVPRSAEAGYLVTKVVAVDGDSGQ
NSWLSYHLFKASDPGLFSVQQQNGEIRTLRQISERDPMMQKLIILVQDHGQPVLSTTASL
NILLVDGFSEPYLQFRDPSKHPTMVNPSTKYLVISLAVLSFLFLLSVTVISIIHICQKIK
YREKITIQEHFYDDCNFPNHLVQGGANGPLSQPCPYEMCSATGTGTSEFRFLKRFMPNFP
FPHGTGEVKTEAGSSVPPDSDRNRSLGSEGHARVPDDYM
Download sequence
Identical sequences G1PP39
ENSMLUP00000012751 ENSMLUP00000012751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]