SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PPF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PPF3
Domain Number 1 Region: 254-526
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.28e-78
Family Nuclear receptor ligand-binding domain 0.00000000155
Further Details:      
 
Domain Number 2 Region: 202-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-29
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  G1PPF3
Domain Number - Region: 175-215
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.0131
Family Hydrophobin II, HfbII 0.014
Further Details:      
 
Domain Number - Region: 118-127
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PPF3
Sequence length 532
Comment (tr|G1PPF3|G1PPF3_MYOLU) Retinoid X receptor beta {ECO:0000313|Ensembl:ENSMLUP00000012885} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RXRB OC=Vespertilionidae; Myotis.
Sequence
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAAGEQQTP
EPEPGETGRDGMGDSGRDSRSPDSSSPNPLSQGAPPHSPPGPPLPPSAAPSLGGSGAPPP
PPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKP
PVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSC
RDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPV
DRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFS
SLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVL
TELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPE
QQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences G1PPF3
ENSMLUP00000012885 ENSMLUP00000012885 XP_006105533.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]