SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PPV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PPV1
Domain Number 1 Region: 7-90
Classification Level Classification E-value
Superfamily PDZ domain-like 9.73e-23
Family PDZ domain 0.0000166
Further Details:      
 
Domain Number 2 Region: 319-348
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000235
Family LIM domain 0.00075
Further Details:      
 
Domain Number 3 Region: 289-318
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000238
Family LIM domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PPV1
Sequence length 364
Comment (tr|G1PPV1|G1PPV1_MYOLU) PDZ and LIM domain 3 {ECO:0000313|Ensembl:ENSMLUP00000013059} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PDLIM3 OC=Vespertilionidae; Myotis.
Sequence
MPQNVVLPGPAPWGFRLSGGIDFNQPLIITRITPGSKAAAANLCPGDVILAIDGFGTESM
THADAQDRIKAAAHQLCLKIDRAETRLWSPQVSEDGKAHPFKINLESEPQDVNYFEHKHN
IRPKPFIIPGRSSGCSTPSGIDGSSGRSTPSSISTVSTICPGDLKVAAKMAPNIPLEMEL
PGVKIVHAQFNTPMQLYSDDNIMETLQGQVSTALGEAPSMSEPTASVPPQSDVYRMLHNN
QDEPTPPRQSGSFRVLQELVNDEKDDRPSGTRSVRAPVTKVHGGGGAAQRMPLCDKCGSG
IVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGELYCETHARARTRPPEGYDTVTL
YPKA
Download sequence
Identical sequences G1PPV1
ENSMLUP00000013059 ENSMLUP00000013059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]