SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PQW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PQW9
Domain Number 1 Region: 1-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.21e-59
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 347-501
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.56e-26
Family Dual specificity phosphatase-like 0.0000817
Further Details:      
 
Weak hits

Sequence:  G1PQW9
Domain Number - Region: 511-582
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000141
Family PLC-like (P variant) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PQW9
Sequence length 582
Comment (tr|G1PQW9|G1PQW9_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000013503} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=GAK OC=Vespertilionidae; Myotis.
Sequence
GGFAFVYEAQDLGSGREYALKRLLSNEEERSRAIIQEVCFLKKLSGHPNIVQFCSAASIG
KEESDTGQAEFLLLTELCRGQLVEFLKKSETKGPLSCDTVLKIFYQTCRAVQHMHRQKPP
IIHRDLKVENLLLSNQGTIKLCDFGSATTVSHAPDYSWSAQRRALVEEEVTRNTTPMYRT
PEIVDLYSNFPISEKQDIWALGCILYLLCFGQHPFEDGAKLRIVNGKYSIPADDTRYSVF
HGLIRATLKVNPEERLSITELVNQLQEIAAARSVNPKSPITELLEQNGGYGNAAPGSAGP
GLAVAEYEQSYGGLLDILRGGPGRLLTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM
SFPAEGVESAIKNNIEDVRLFLDSKHPGHYAVYNLSSRTYRPAKFHNRVSECGWAARRAP
SLRSLYSICRDMHWWLRQDHKNVCVLHCTDGRAASAVAVCSFLCFCRLFSTAEAAVYMFS
MKRCPPGIWPSHKRYIEYMCDMVAEEPITPHSKPILVRAIVMTPVPLFNKQRSGCRPFCE
VYVGDERVATTSQEYDRMRDFRIEDGKAVIPLGTAVQGDVLI
Download sequence
Identical sequences G1PQW9
ENSMLUP00000013503 ENSMLUP00000013503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]