SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PRC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PRC7
Domain Number 1 Region: 216-332
Classification Level Classification E-value
Superfamily SH2 domain 9.56e-28
Family SH2 domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PRC7
Sequence length 348
Comment (tr|G1PRC7|G1PRC7_MYOLU) Src homology 2 domain containing transforming protein D {ECO:0000313|Ensembl:ENSMLUP00000013684} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=SHD OC=Vespertilionidae; Myotis.
Sequence
MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYLEQKNLDFEDPYEDADSRLEPDSAGP
GDSKYDSPKHRLIKVEAADMAEVARAKVLLGSAGAESEVDTEYSDPFDAQPHPPPPDDGY
MEPYDAQRVVSELPCRAVQLYDTPYEEQDGEPGDRPFSGQRPGQSRQPQEDERPADEYDQ
PWEWKKDHISKAFAVQFDSPEWERTPGSAKELRKPPPRSPHLAERVDPALPLEKQPWFHG
PLSRADAENLLLLCKEGSYLVRLSETSPQDCSLSLRSSQGFLHLKFAWTRENQLVLGQHS
GPFASVPELVLHYSSRPLPVQGAEHLALLYPVVTQSPCPGASAPGPAP
Download sequence
Identical sequences G1PRC7
ENSMLUP00000013684 ENSMLUP00000013684 XP_006107157.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]