SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PRE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PRE9
Domain Number 1 Region: 17-147
Classification Level Classification E-value
Superfamily PH domain-like 1.38e-23
Family Pleckstrin-homology domain (PH domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 147-239
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000011
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PRE9
Sequence length 402
Comment (tr|G1PRE9|G1PRE9_MYOLU) Signal transducing adaptor family member 2 {ECO:0000313|Ensembl:ENSMLUP00000013711} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=STAP2 OC=Vespertilionidae; Myotis.
Sequence
MASALGPPRAPKPKCALPSHYHESFLEKKGPRQGDDYKKFWAGLQGLTLYFYKSNRDSQH
VEKIDLGASVKVTDEAPCGSSHDPGIHFNLFVRNQEIKFRVESLESREMWKGFILTVVEL
RVPSNLTLLPGHLYMMAEALAKEEARRALEMPSCFMKVSRLEAQLLLERYPECGNLLLRP
SGDGKDCVSVSTRQTLSGTPLVRHYKVKREGPKYVIDVEEPVSCASLQAVVNYFVLQTKN
ALVPFLLDEDYEKVLGYVEADKENGESVWVAPLAPAVLCPGAAAPAGGPKQPPPVPRQHK
LPPLLNPDENYVIPIGDAPVAEYENTDALSPGWPKQCHPAQKVQAKLPKPPMAPKPEPKC
LASGLAKKLAISSAQAAFPTTGLANVTAELEEKLQRRRALEH
Download sequence
Identical sequences G1PRE9
ENSMLUP00000013711 ENSMLUP00000013711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]