SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PRI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PRI7
Domain Number 1 Region: 54-386
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 9.06e-71
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.00000000000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PRI7
Sequence length 387
Comment (tr|G1PRI7|G1PRI7_MYOLU) Hypoxia inducible factor 1 alpha subunit inhibitor {ECO:0000313|Ensembl:ENSMLUP00000013755} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=HIF1AN OC=Vespertilionidae; Myotis.
Sequence
IININCLNIPSLWFPLCFLRNRRGFRFRGPSLAAEMAATAAEAAASGSGGPREEAEAPGP
AWNESQLRSYSFPTRPIPRLSQSDPRAEEFIENEEPVVLTDTNLVYPALKWDLDYLQENI
GHGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGGEREH
RLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDE
QQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYE
TVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNI
EKMLGEALGNPQEVGPLLNTMIKGRYN
Download sequence
Identical sequences G1PRI7
ENSMLUP00000013755 ENSMLUP00000013755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]