SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PS60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PS60
Domain Number 1 Region: 313-449
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000000123
Family CBS-domain pair 0.0073
Further Details:      
 
Weak hits

Sequence:  G1PS60
Domain Number - Region: 544-596,627-653
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000144
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PS60
Sequence length 711
Comment (tr|G1PS60|G1PS60_MYOLU) Cyclin and CBS domain divalent metal cation transport mediator 3 {ECO:0000313|Ensembl:ENSMLUP00000013994} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=CNNM3 OC=Vespertilionidae; Myotis.
Sequence
AAAAAGRLGWLLAALCLGHAAGEVAQGPRVLGICLEQAGSAGAAWARGGEVPAVPEATFR
LRLFGSGFGNSSWSWAAPEGAGCPEGGPAAAPGEAAAAPTGEWRALLRLRAEAEHPHSAL
LAVXXXXXXXXXXXRRCDLSAWLGAAGLLALAALARGLQLSALVLAPAEVQVLRENGSEA
ERAAPRGLESARRWASYALSALLLLACLAQAALAVLLYRAAGQRAVPAVLGSAGLAFLVA
EVLPAAVSGRWTLALAPRALALSRLAVLLTLPVALPVGQLLELAARPGRLRERVLELARG
GGDPYSDLSKGVLRYRTVEEVLTPLEDCFMLDASTVLDFGVLASIMQSGHTRIPVYEEER
SNIVDMLYLKDLAFVDPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLAIV
QKVNNEGEGDPFYEVLGLVTLEDVIEEIIKSEILDESEDYRDTTVRKKPAALSVPLRRKE
EFSLFKVSDNEYKVKISPQLLLATQRFLSREVDVFSPLRISEKVLLHLLRHPSVNQEVRF
DQSNRLAAHHYLYQRSQPVDYFILILQGRVEVEIGKEGLKFENGAFTYYGLSALTAPSSV
HQSPVSSLQSLCHDPQPEPADGTRLSTYCPDYTVRALSDLQFIKVTRLQYLNALLASRAQ
NLPPSPENLDLQVIPGSLTRLLGDRTAAAAGSNHGGPGLPAEESPGRNPGV
Download sequence
Identical sequences G1PS60
ENSMLUP00000013994 ENSMLUP00000013994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]