SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PSB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PSB1
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 1.21e-26
Family SH2 domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000131
Family SOCS box-like 0.0000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PSB1
Sequence length 198
Comment (tr|G1PSB1|G1PSB1_MYOLU) Suppressor of cytokine signaling 2 {ECO:0000313|Ensembl:ENSMLUP00000014051} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=SOCS2 OC=Vespertilionidae; Myotis.
Sequence
MTLRCVEPSGNGAEGTRSQWGTAGSAEEPSPEAAPLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
Download sequence
Identical sequences G1PSB1
ENSMLUP00000014051 XP_006084090.1.53796 XP_006084091.1.53796 XP_006084092.1.53796 XP_006084093.1.53796 ENSMLUP00000014051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]