SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PT48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PT48
Domain Number 1 Region: 614-908
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-82
Family Protein kinases, catalytic subunit 0.000000000583
Further Details:      
 
Domain Number 2 Region: 30-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-75
Family Ephrin receptor ligand binding domain 0.000000831
Further Details:      
 
Domain Number 3 Region: 328-532
Classification Level Classification E-value
Superfamily Fibronectin type III 5.38e-40
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 4 Region: 911-982
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.27e-21
Family SAM (sterile alpha motif) domain 0.0000429
Further Details:      
 
Weak hits

Sequence:  G1PT48
Domain Number - Region: 269-303
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0167
Family TNF receptor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PT48
Sequence length 987
Comment (tr|G1PT48|G1PT48_MYOLU) EPH receptor A4 {ECO:0000313|Ensembl:ENSMLUP00000014382} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=EPHA4 OC=Vespertilionidae; Myotis.
Sequence
MAGIFYFVLFSFLFGTCNAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRESQFAKIDTIAADESFTQVDIGDRIMKLNTEVRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEERNGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGAISCTCDRGFFRADSDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDSSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS
KYNPSPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVAGSVVLVVILIAAFVISRSRRSKYSKAKQEADEEKHLNQGVRTYVDP
FTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGY
TDKQRRDFLSEASIMGQFDHPNIIHMEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFT
VIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAY
TTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEE
GYRLPPPMDCPISLHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPSSLKRTGTESSRPN
TALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMNQDDLARIGITAV
THQNKILSSVQAMRTQMQQIHGRMVPV
Download sequence
Identical sequences G1PT48
ENSMLUP00000014382 ENSMLUP00000014382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]