SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PT89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PT89
Domain Number 1 Region: 53-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.93e-46
Family Regulator of G-protein signaling, RGS 0.00000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PT89
Sequence length 181
Comment (tr|G1PT89|G1PT89_MYOLU) Regulator of G protein signaling 5 {ECO:0000313|Ensembl:ENSMLUP00000014434} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RGS5 OC=Vespertilionidae; Myotis.
Sequence
SCTSAAAMAEEHVCTAKEIKIKLGTLLQKPDPAADLVIPYNEKPEKPAKTQKPSPEEALQ
WRDSLDKLLQSSYGLASFKSFLKSEFSEENLEFWMACEDFKKTKSATKMAEKAKKIYEEF
IQTEAPKEVNIDHFTKDITVRNLVEPSPSSFDVAQKRVHALMEKDSLPRFVRSEFYQEFI
K
Download sequence
Identical sequences G1PT89
ENSMLUP00000014434 ENSMLUP00000014434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]