SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PU12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1PU12
Domain Number - Region: 111-153
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0141
Family FCH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PU12
Sequence length 196
Comment (tr|G1PU12|G1PU12_MYOLU) BLOC-1 related complex subunit 5 {ECO:0000313|Ensembl:ENSMLUP00000014754} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=BORCS5 OC=Vespertilionidae; Myotis.
Sequence
MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIP
TFQPLLKGLLSGQTSPTNTKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE
MDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLMERLNSMLPEG
ERLEPFSMKPDRELKL
Download sequence
Identical sequences G1PU12
ENSMLUP00000014754 ENSMLUP00000014754 XP_005866874.1.60319 XP_006084311.1.53796 XP_006760283.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]