SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PU99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PU99
Domain Number 1 Region: 155-295
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-35
Family cAMP-binding domain 0.00000178
Further Details:      
 
Domain Number 2 Region: 21-147
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-32
Family cAMP-binding domain 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PU99
Sequence length 305
Comment (tr|G1PU99|G1PU99_MYOLU) Protein kinase cAMP-dependent type II regulatory subunit alpha {ECO:0000313|Ensembl:ENSMLUP00000014848} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PRKAR2A OC=Vespertilionidae; Myotis.
Sequence
VCAEAYNPDDEEEDTEPRVIHPKSDEQRCRLQEACKDILLFRNLDQEQLSEILDAMFEKI
VKADEHVIDQGDDGDNFYVIERGTYDILVTKDDQTRAVGQYDNRGSFGELALMYNTPRAA
TIVATSEGALWALDRGTFRRIIVKNNAQKRKTYESFLESVPLLKSLEVSERMKIVDVIGE
KAYKDGERIIAQGEKADSFYIIESGEVSILIKSKTKVNKEGGNQEVEIARCHKGQYFGEL
ALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSLDL
GDPGQ
Download sequence
Identical sequences G1PU99
ENSMLUP00000014848 ENSMLUP00000014848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]