SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PUH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PUH5
Domain Number 1 Region: 16-114
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PUH5
Sequence length 427
Comment (tr|G1PUH5|G1PUH5_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000014933} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PLEKHO2 OC=Vespertilionidae; Myotis.
Sequence
QGVKEAGEKPQRARTADKAGWIKKSSGGFLGLWKDRYLLLCQAQLLVYENEDEQKCVETV
ELGSYEKCQDLRALLKRKHRFILLRSPGNKVSNIKFQAPNGEEKESWIKALNEGISRGKN
KAFDEIKVDKSCALEHVTRNRVRGGQQRRPPTRIHLKEVASAASDGLSRLDLDALDSRPP
VLTPGNDVNAAQPREALRPLMPPAKPSPAPEVTVLGDRGETPVGERAPTPVSASSEAQPE
SQEDSETAVGEDSSSEQLPRVLPEKLKVSWDNSSPEEPPVPESAEPPQVPCSETSEASAK
EGGKPPTPPPKILSELRASMIGVEASGPARSPGASETSAPGSAQVSVNXQLEVQVASEQT
EPLLNKMLASEPAPVSAETLLSEAVEQLRQATQVLQEIRDLGDLSQEAPGLREKRKELVT
LYRRSAP
Download sequence
Identical sequences G1PUH5
ENSMLUP00000014933 ENSMLUP00000014933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]