SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PV97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1PV97
Domain Number - Region: 116-188
Classification Level Classification E-value
Superfamily Cadherin-like 0.000675
Family Dystroglycan, N-terminal domain 0.04
Further Details:      
 
Domain Number - Region: 3-32
Classification Level Classification E-value
Superfamily DNA-binding domain of EIN3-like 0.0641
Family DNA-binding domain of EIN3-like 0.0098
Further Details:      
 
Domain Number - Region: 190-224
Classification Level Classification E-value
Superfamily Photosystem I reaction center subunit X, PsaK 0.0785
Family Photosystem I reaction center subunit X, PsaK 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PV97
Sequence length 473
Comment (tr|G1PV97|G1PV97_MYOLU) Sarcoglycan epsilon {ECO:0000313|Ensembl:ENSMLUP00000015244} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=SGCE OC=Vespertilionidae; Myotis.
Sequence
MQFPPWWELGDPCAWTGQGRGTRRMSPWTTGTFLLTAFLLSSADGISGTVNWKTKQANNF
IVSRKMAAGKKHVYTIFSKVHSDRDVYPSAGVLFVHVLERESFKGEFPPYPKPGEISNDP
ITFNTNLMGYPDRPGWLRYIQRTPYSDGVLYGSPTAENVGKPTIIEITAYNRRTFETARH
NLIINIMSAEELDFPLPYQAEFFIKNMNVEEMLASEVLGDFLGAVKNVWQPERLNAINIT
SALDRGGRVPLPINDMKEGVYVMVGADVPFSSCLREVENPQNQLRCSQEMEPVITCDKKF
RSQFYIDWCKISLVDKTKQVSTFQEVIRGEGILPDGGEYKPPSDSLKSRDYYTDFLITLA
VPSAVALVLFLILAYIMCCQREGVEKRNMQTPDIQLVHHSAIQKSTKELRDMSKNREIAW
PLSTLPVFHPVTGEIIPPLHADSYESTNMPLMQTQQNLPHQTQIPQQQTTGEC
Download sequence
Identical sequences G1PV97
ENSMLUP00000015244 ENSMLUP00000015244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]