SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PVI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PVI4
Domain Number 1 Region: 230-350
Classification Level Classification E-value
Superfamily Cadherin-like 4e-31
Family Cadherin 0.0015
Further Details:      
 
Domain Number 2 Region: 443-565
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-28
Family Cadherin 0.0032
Further Details:      
 
Domain Number 3 Region: 344-447
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-24
Family Cadherin 0.003
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-22
Family Cadherin 0.0061
Further Details:      
 
Domain Number 5 Region: 559-671
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000157
Family Cadherin 0.0021
Further Details:      
 
Domain Number 6 Region: 30-123
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000113
Family Cadherin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PVI4
Sequence length 799
Comment (tr|G1PVI4|G1PVI4_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000015350} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MVITPEGRLGSRCLLLSLMFLAVWEAGSGQVLYSVPEEAKHGTFVGRIAQDLGLELAELV
PRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSLECSIHLEVVVERPLQVFHVE
VEVKDINDNPPVFPVKEQRVLIYESRLPDSLFPLEGASDEDVGVNSILTYKLSSSEYFSL
DVKTNSDDNTQIGLVLRKSVDREETPTHNLLLTATDGGKPELTGSVQVLVTVMDVNDNAP
RFSQSEYEVRIFENSDNGTIVIRLNASDPDEGINREISYSFNSFVPPMVIDQFSIDSNSG
EIKIRKNLDFEKVKSYKIRIDATDRGHPPMAGHCTVLVKVLDENDNSPEVVVTSLSLPVL
EDAQLGTVIALISVSDRDSGANGQVTCSLTPNVPFKLVSTFKNYYSLVLDSALDRESVAN
YELVLTARDGGSPSLSSTASLSVEVADVNDNAPLFAQPEYTVFVKENNPPGCHIFTVSAR
DMDAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDA
GVPPLGSNVTLQVFVLDENDNAPALLPPAPGGPGGAVSELVSGSVGAGHVVAKVRAVDAD
SGYNAWLSYELLPAAGGARSPFRVGLYTGEISTTRALDEADSPRQRLLVLVKDHGEPALA
VTATVLLSLVDSSQAPKTSLRVSSGAMSAETALVDVNVYLIIAICAVSSLLVLSLLLYTA
LRCWALPTQGVCGPGKPVLVCSSAVGSWSYSQQRRQRVCSGEGPPKTDLMAFSPSLPPCP
VPEVETEGQSIGGDHSRKV
Download sequence
Identical sequences G1PVI4
ENSMLUP00000015350 ENSMLUP00000015350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]