SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PVN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PVN7
Domain Number 1 Region: 1-278
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.75e-57
Family Bacterial PLC 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PVN7
Sequence length 287
Comment (tr|G1PVN7|G1PVN7_MYOLU) Phosphatidylinositol specific phospholipase C X domain containing 3 {ECO:0000313|Ensembl:ENSMLUP00000015414} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PLCXD3 OC=Vespertilionidae; Myotis.
Sequence
GSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRY
FDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHRKEVVFLDFNHFYGMQKYH
HEKLVQMLKDIYGNKMCPAIFAQEVSLKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPA
PWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALP
AMMQWVSTQKPGESGINIVTADFVELGDFISTVIKLNYVFDEGEANT
Download sequence
Identical sequences G1PVN7
ENSMLUP00000015414 ENSMLUP00000015414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]