SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PVW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PVW4
Domain Number 1 Region: 77-203
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.51e-47
Family Regulator of G-protein signaling, RGS 0.000000454
Further Details:      
 
Weak hits

Sequence:  G1PVW4
Domain Number - Region: 11-52
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0968
Family Troponin I 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PVW4
Sequence length 235
Comment (tr|G1PVW4|G1PVW4_MYOLU) Regulator of G protein signaling 18 {ECO:0000313|Ensembl:ENSMLUP00000015509} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RGS18 OC=Vespertilionidae; Myotis.
Sequence
METSLLFFSQRNMWESKEKTFFKLMPGSAKEEASKEAKIRAKEKRNRLSLLLQKSEFHEE
PQARRSAHLAGVTRVCPEEAIRWGESFDKLLSHKDGLETFTRFLKTEFSEENIEFWMACE
DFKKSKDPQQMILKAKAIYEKFIQNDAPQEVNLDFHTKELIVKSITQPTLHSFDAAQSRV
YQLMEQDSYTRFLKSDIYSDLVEGRPQRPTNLRRRSRSFTYNEFQDVKSDVAIWF
Download sequence
Identical sequences G1PVW4
ENSMLUP00000015509 XP_006094386.1.53796 ENSMLUP00000015509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]