SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PWB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PWB8
Domain Number 1 Region: 54-838
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.48e-284
Family Motor proteins 2.45e-16
Further Details:      
 
Domain Number 2 Region: 839-964
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.97e-22
Family Myosin rod fragments 0.00031
Further Details:      
 
Domain Number 3 Region: 959-1075
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.46e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1244-1352
Classification Level Classification E-value
Superfamily Myosin rod fragments 6.67e-18
Family Myosin rod fragments 0.0025
Further Details:      
 
Domain Number 5 Region: 1063-1153
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000575
Family Myosin rod fragments 0.0034
Further Details:      
 
Domain Number 6 Region: 1352-1453
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000589
Family Myosin rod fragments 0.0088
Further Details:      
 
Domain Number 7 Region: 1517-1630
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000353
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 8 Region: 1762-1863
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000447
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 
Weak hits

Sequence:  G1PWB8
Domain Number - Region: 27-60
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.00216
Family Myosin S1 fragment, N-terminal domain 0.0013
Further Details:      
 
Domain Number - Region: 1855-1925
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0942
Family Myosin rod fragments 0.017
Further Details:      
 
Domain Number - Region: 1161-1234
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0994
Family Myosin rod fragments 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PWB8
Sequence length 1963
Comment (tr|G1PWB8|G1PWB8_MYOLU) Myosin heavy chain 9 {ECO:0000313|Ensembl:ENSMLUP00000015682} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=MYH9 OC=Vespertilionidae; Myotis.
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKNGFEPASLKEEVGDEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDSAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETCILMKSRAIRQAKDERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDLFQETMEAMRIMSIPEDEQIGLLRVISGVLQLSNIVFKKERNT
DQASMPDNTEILAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEAL
AKASYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQ
QLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKA
TDKSFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIA
TLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKL
MATLRNTNPNFVRCIIPNHEKKSGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEF
RQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDL
KITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPL
LQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCA
EAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEES
ARQKLQLEKVTTEAKLKKLEEDQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKS
LAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQ
LAKKEEEVQAALARVEEEATQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDL
GEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQA
VEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKALLQGKGDSEHKRKKVEAQLQEL
QVKFNDGERVRTELADKVTKLQVELDNVTGLLTQSDSKSSKLTKDFSTLESQLQDTQELL
QEENRQKLSLSTKLKQVEDEKNSLKEQLEEEEEAKRNLEKQMTTLQAQVTDMRKKMDDGV
GCLETAEEAKRKLQKDLEGLSQRYEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVS
NLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELER
LNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLR
LEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSLAVAARKKLEL
DLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDYMRELDDTRASREEILAQAKENEKKLKS
MEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEE
LEEEQGNTELVNDRLKKANLQIDQINTDLNLERSHAQKNENARQQMERQNKELKVKLQEM
EGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRAEKKLKDVLLQVDDERRN
AEQFKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSL
KNKLRRGDLPFVVPRRMARKGTGECSDDEVDGKADGAEAKAAE
Download sequence
Identical sequences G1PWB8
ENSMLUP00000015682 ENSMLUP00000015682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]