SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PWZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PWZ6
Domain Number 1 Region: 330-464
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-23
Family Nuclear receptor ligand-binding domain 0.00000666
Further Details:      
 
Domain Number 2 Region: 100-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000194
Family Nuclear receptor 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PWZ6
Sequence length 465
Comment (tr|G1PWZ6|G1PWZ6_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000015945} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
RMVDTESPICSLFPLEADDLESPLSEEFLQEMGSIQDMSQSLGEDSSGSFSFTDYQYLGS
GPGSEGSVITDTLSPASSPSSVSYPVVPGSAEEASSTALNIECRICGDKASGYHYGVHAC
EGCKLFYTQCLSLRKQHDRKKDTCRHLRLPGQCVPLQFHAHFLGTNIDVIREGKLNLCKL
SRPNYIAFQNYVSEFSSSQKRSLARRIYEAYLRNFNMNKAKARGFLAGKAANNPPGWQEE
LETGLRWWENIYPEARGPGQGDASVRPSSCCPAPSVTRRLRCRALLRAALREGAARLADE
DVGLSLGPGARVPWVLMSRLKPPPWESQAGSCSHRRQLVSAARGRGTDALIPSRRLRSLT
SSLSLGFSELKVWLAVVMSCSGTDRPGLLHVGQIEKMQEGIVHVLRLHLQGNHPDAAFLF
PKLLQKMADLRQLVTEHAQLVQVIKRTEADAALHPLLQEIYRDMY
Download sequence
Identical sequences G1PWZ6
ENSMLUP00000015945 ENSMLUP00000015945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]