SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PY39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PY39
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.08e-34
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PY39
Sequence length 300
Comment (tr|G1PY39|G1PY39_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000016371} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
RKRWHLFSPEDTPFLYPTRIPYEESSVFSKVNVVNPDVKRFPQFQKARRHVVTLSPGQVL
FVPRHWWHYVESVDPVTVSINSWIELEEDHQARVEEAIARMLVCALKTAEDPHSTRAWLN
PTEVEETSHEVNCRYLNRAVSAFFDHYRTSKTEIQALRTHGEHMEKEEFNMHNNLMEVDQ
TGSQNLTLGTVGEQAACPFGPDLVPVLPSSENPPSETGGMFKNDGKDFVGKAGEHFDKLH
CTKKQRMMRGRENEIVEQVASNSTMAPSQTFISTDDLLDCLVNPQVTKIVAQLLIQGRSL
Download sequence
Identical sequences G1PY39
ENSMLUP00000016371 ENSMLUP00000016371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]