SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PYK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PYK5
Domain Number 1 Region: 120-398
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-75
Family Protein kinases, catalytic subunit 0.00000000014
Further Details:      
 
Domain Number 2 Region: 387-444
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000841
Family SH3-domain 0.0017
Further Details:      
 
Weak hits

Sequence:  G1PYK5
Domain Number - Region: 7-69
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0321
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PYK5
Sequence length 708
Comment (tr|G1PYK5|G1PYK5_MYOLU) Tyrosine kinase non receptor 2 {ECO:0000313|Ensembl:ENSMLUP00000016537} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=TNK2 OC=Vespertilionidae; Myotis.
Sequence
MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRLEAEFPPHHSQSAFPKTSPTPGGPAGEGPLQSLTCL
IGEKDLRLFEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNA
MHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGM
GYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPE
SLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDI
YNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRA
ENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPD
KIDELYLGNPMDPPDLLSVELSTSRPTQHLGRVKREPPPRPPQPAIFTKKPTYDPVSEDQ
DPLSSDFKRPGVRKPGLPRGLWLTKPSARVSGTKTGRSGGGAEVTLIDFGEEPVVPSPRP
YTPSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDD
FEVCSINSTLVGAGVSPGASQGETNYGFVLSRRGLFASSGGQPVLLTP
Download sequence
Identical sequences G1PYK5
ENSMLUP00000016537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]