SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PZ32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PZ32
Domain Number 1 Region: 330-399
Classification Level Classification E-value
Superfamily Immunoglobulin 8.78e-19
Family I set domains 0.0007
Further Details:      
 
Domain Number 2 Region: 38-138
Classification Level Classification E-value
Superfamily Immunoglobulin 3.19e-17
Family V set domains (antibody variable domain-like) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PZ32
Sequence length 408
Comment (tr|G1PZ32|G1PZ32_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000016714} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MESPSASSHRGLVPWQGLLLAISLLTFWSPPTTAQLAIVPTNAAEGKDVLLRIRNKPPDA
VGFLWYRGEGARSQRNIASIVVDLRVHALGPAYSGREKVNSDGSMLLKRVTRKDTGYYTI
VARLRDSKKEIGFGQLRVYHTELIALDSAPSPSASHSGLGLGIYCRTHTVETNFLRSEFP
SQIPALQTFSTERRASLIGVTQQSQGPIRCLWFPRPTIGSDPSFLGVLSSEETPNTSGSQ
GNTLRLDNGGLCSWKEWSPVSQAVSWSVKIRKKSGVVSVSQSLWKTQRYHTGQFSLSPTP
NITSNNSNLAHTLCVSAEPVRVPTLLASNTTVMEHKDSVVLTCYTNAVSTQWFFNGMNLR
QTERKKLSWNNRTLTIDPVRREDAGNYQCEVSNPISSTESEPVELDVK
Download sequence
Identical sequences G1PZ32
ENSMLUP00000016714 ENSMLUP00000016714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]