SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PZ89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PZ89
Domain Number 1 Region: 230-361
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-31
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 440-572
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 5.1e-24
Family Cadherin 0.0026
Further Details:      
 
Domain Number 4 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-20
Family Cadherin 0.0054
Further Details:      
 
Domain Number 5 Region: 555-664
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-16
Family Cadherin 0.0035
Further Details:      
 
Domain Number 6 Region: 30-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.000006
Family Cadherin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PZ89
Sequence length 796
Comment (tr|G1PZ89|G1PZ89_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000016771} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=LOC102418321 OC=Vespertilionidae; Myotis.
Sequence
METPLPKAPRKRQVTAIIILLLLWEAGGATINYSVLEERESGSFVANLAKDLGLGLGELA
ARGARILSKGNRQHLQLEQKSGYLLLKEKLDREELCGDTDPCILHFQVLLKNPLQFIQGE
LQLRDVNDHAPEFLEQEILLKIPESSHPGTAIPLKTAQDLDVGSNTVQNYTISTNPHFHL
FTRSHSDGRRYPELVLDKTLDREEQSELRLTLTALDGGSPPRTGTSQVVVAVLDINDNAP
EFAQLLYEVQVSENSPVGSLVITVSARDLDAGTHGELSYSFFQSSNHAIQVFEINAVTGE
LRLKRMLDFEEIRSYRMEIEASDGGGLSGKCTVAIEVMDINDNAPELTMSLLIRDIPENT
PDAVVAVFGISDPDSGDNGKMTCVIQDHLPFLLKLTVENFYTLVTEGALDRENQAEYNIT
ITVTDMGTPRLKTQHNITLLVSDVNDNAPAFTQTSYTLFLRENNSPALHIGSVSATDRDA
GANAQLTYSLLPPHDPQLPLASLVSINADNGHLFALRALDFEALQAFEFRVGATDRGSPA
LSSQALVRVQVLDANDNAPFVLYPLQNGSAPCTELVPRAAEPGYLVSKVVAVDADSGQNA
WLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLLVLVKDNGEPALSASVTLHV
LLVDGFSQPYLPLPEAAADQAQADPLTVYLVIALASVSSLFLFSVLAFIAVRLCRRSRAA
WVGGCSVPEGHLPGHLVDVSGTGTLSQSYQYEVCLTGGSGSNEFKFLKPIIPNLLPQGAN
EEIEGNATFQNNFGFN
Download sequence
Identical sequences G1PZ89
ENSMLUP00000016771 XP_006086525.1.53796 ENSMLUP00000016771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]