SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q034 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q034
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000222
Family Ubiquitin-related 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1Q034
Sequence length 130
Comment (tr|G1Q034|G1Q034_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000017066} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MADENPKEGVKTENQDHINLKVAGQDGSVVQFKIKRHAPLSNLMKAYCERTKKTFSIRKL
QFGFNTSDYHNKVTDVCAEAFEFFSTKWPMKNQVFCNSSKPSQFDKNIGTIYPFPLPNPL
FPSAYLKPCF
Download sequence
Identical sequences G1Q034
ENSMLUP00000017066 ENSMLUP00000017066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]