SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q047 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q047
Domain Number 1 Region: 120-200
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000106
Family Translational machinery components 0.015
Further Details:      
 
Domain Number 2 Region: 46-107
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000345
Family Ribosomal S5 protein, N-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1Q047
Sequence length 235
Comment (tr|G1Q047|G1Q047_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000017079} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
AEIKDWTPITKPGRLVNDMIKSLEEICHFSLLIKESIIDFFLEALLKVEALKIMYMQKQT
HGQRTWFKAFVVFVDYGHVSLGVKCSKEVATAVCGVIILAKLSVVPVQGGYQGNKIGKSH
TVPCKVTGHCGSVLVASSLPPRATGIDSAAVPKKLLLLASIHNCYTSSRRCTASLGNFAE
ATFEAISKTYSCLTPDPWKETMFTKSPYQELTDHLVKIHTKVFVQRIRAPAVATT
Download sequence
Identical sequences G1Q047
ENSMLUP00000017079 ENSMLUP00000017079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]