SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q1E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q1E0
Domain Number 1 Region: 16-170
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.34e-48
Family Cyclophilin (peptidylprolyl isomerase) 0.00000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1Q1E0
Sequence length 171
Comment (tr|G1Q1E0|G1Q1E0_MYOLU) Peptidyl-prolyl cis-trans isomerase {ECO:0000256|RuleBase:RU363019} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
KPSILALQTPQPRSHPCPAMVNPNVFFNIIIDGKSLGHVSFELFCALSTGEKGFGYKVSC
FHRIILGFMCQGGDFTHHNGTGGKSIYGEKFDDENFILKHMGPGLATANAGPNTNSSQFL
IGTAKPERLDGKHVAFGQVSGSMDIVAATECFGSRMAGPSGKIINADCGQC
Download sequence
Identical sequences G1Q1E0
ENSMLUP00000017523 ENSMLUP00000017523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]