SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q1M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q1M3
Domain Number 1 Region: 85-385
Classification Level Classification E-value
Superfamily BEACH domain 6.15e-128
Family BEACH domain 0.0000000000139
Further Details:      
 
Domain Number 2 Region: 494-747
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.4e-32
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 3 Region: 16-80
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-19
Family PreBEACH PH-like domain 0.0000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1Q1M3
Sequence length 760
Comment (tr|G1Q1M3|G1Q1M3_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000017606} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=NBEA OC=Vespertilionidae; Myotis.
Sequence
APGTQASLIAPASSVSQVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVM
FNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLYKSSNMTQRWQRREISNFE
YLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLPGNFRDLSKPIGALNPKRAVFY
AERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNANDGKFDHPNRTFSSVA
RSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYSLGVREDEVVINNVDLPPWAKKPEDFV
RINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSMNLDSITDPVLR
EAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLSPLMFKDQMQQDVIMVLKFPSNSPVTHVA
ANTLPHLTIPAVVTVTCSRLFAVNRWHNTVEHAGRTKDQAHHLPIEMDPLIANNSGVNKR
QITDLVDQSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCL
ARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDYPAPRAVLTGHDHEVVCV
SVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRF
SNFSINGKLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAG
IRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY
Download sequence
Identical sequences G1Q1M3
ENSMLUP00000017606 ENSMLUP00000017606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]