SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q1Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q1Y6
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-38
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 1.14e-36
Family Link domain 0.00000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1Q1Y6
Sequence length 277
Comment (tr|G1Q1Y6|G1Q1Y6_MYOLU) TNF alpha induced protein 6 {ECO:0000313|Ensembl:ENSMLUP00000017719} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=TNFAIP6 OC=Vespertilionidae; Myotis.
Sequence
MIILIYLFVLLWEDAHGWGFKNGIFHNSIWLEQAAGVYHREARSGKYKLTYTEAKAVCEY
EGGRLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPHCGFGKTGIIDYGIRLNRS
ERWDAYCYNPHAKECGGIFTDPKRIFKSPGYPNEYDDNQICYWHIRLKYGQRIHLKFLDF
DLEDDPSCLADYVEIYDSYDDIHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGF
QIKYVAVDPLSNSSQGKNTSTTSTGNKNFLAGRFSHL
Download sequence
Identical sequences G1Q1Y6
ENSMLUP00000017719 XP_006098546.1.53796 ENSMLUP00000017719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]