SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q2E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q2E9
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.3e-31
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1Q2E9
Sequence length 117
Comment (tr|G1Q2E9|G1Q2E9_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000017882} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
QIPELKQDISIPDYCCLGDGEEEEITINAWFGPPGTVSPLHQDPQKNFLAQVLGRKYIRL
YSPQESEAVYPHDTHLLHNTNQVGLENPDLKNFPRFAEPFLSCILSPGELLFIPVKY
Download sequence
Identical sequences G1Q2E9
ENSMLUP00000017882 ENSMLUP00000017882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]