SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1Q2I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1Q2I5
Domain Number 1 Region: 78-164
Classification Level Classification E-value
Superfamily HMG-box 3.27e-32
Family HMG-box 0.00000625
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily HMG-box 9.43e-27
Family HMG-box 0.00000511
Further Details:      
 
Weak hits

Sequence:  G1Q2I5
Domain Number - Region: 167-212
Classification Level Classification E-value
Superfamily ARM repeat 0.000633
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1Q2I5
Sequence length 215
Comment (tr|G1Q2I5|G1Q2I5_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000017918} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=HMGB1 OC=Vespertilionidae; Myotis.
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEEDEEDDEEEEEEEDEEEDDEEEDDDDE
Download sequence
Identical sequences G1Q2I5
ENSMLUP00000017918 ENSMLUP00000017918 XP_006085523.1.53796 XP_008157678.1.99482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]